PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G221500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 285aa    MW: 30624.2 Da    PI: 5.7404
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G221500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.8e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eEd++lv +++q+G ++W++ +r  g+ R++k+c++rw +yl
  Sevir.9G221500.1.p 14 RGAWSPEEDQRLVAYIRQHGHPNWRALPRQAGLLRCGKSCRLRWINYL 61
                        89******************************99************97 PP

2Myb_DNA-binding475.8e-1567111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+++++E+ l+v+++ +lG++ W++Ia+ ++ gRt++++k+ w+++
  Sevir.9G221500.1.p  67 RGNFSADEEALIVRLHLELGNR-WSAIAAQLP-GRTDNEIKNVWHTH 111
                         89********************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.045965IPR017930Myb domain
SuperFamilySSF466892.81E-2811108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002497.5E-161461IPR001005SANT/Myb domain
CDDcd001673.75E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2565116IPR009057Homeodomain-like
SMARTSM007171.3E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129418.70766116IPR017930Myb domain
PfamPF002491.9E-1367111IPR001005SANT/Myb domain
CDDcd001673.14E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRAPCCEKE GLRRGAWSPE EDQRLVAYIR QHGHPNWRAL PRQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SADEEALIVR LHLELGNRWS AIAAQLPGRT DNEIKNVWHT HIKKRLEDDA  120
EANAAAAGGG RPKQQKARKS KPAAAAKKAT AAAAAVSDSS EQQPFTTASP GLSSSVSSGE  180
TTFSTATEST AAVSSGDNAA TTSASPQPGA AKAEMEMESF SSAEFPPIDE SFWSSPDVVD  240
MGLGAMDEEL GLAGPPSLST RDEDMEFWLK MLLEAGDMRD LSVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794081e-168HF679408.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB2 protein.
GenBankJQ2554781e-168JQ255478.1 Saccharum hybrid cultivar Co 86032 MYB46 (MYB46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982863.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH43e-79MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLK4ANN00.0K4ANN0_SETIT; Uncharacterized protein
STRINGSi040527m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-70myb domain protein 15